PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100253220041
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 376aa    MW: 42849.3 Da    PI: 6.3201
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100253220041genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like60.73e-19111162153
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkY 53 
                                   kpr++Wt+ LH++F e+v+q+ G ++A Pk+ilelm+++ L++e+v+SHLQ Y
  Ote100253220041|100253220041 111 KPRVVWTSHLHNKFEEVVRQI-GVQHAGPKKILELMGIPWLSRENVASHLQVY 162
                                   79*******************.9****************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521721.57E-6160IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.5E-9161No hitNo description
SuperFamilySSF466891.79E-14109167IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.0E-20110163IPR009057Homeodomain-like
TIGRFAMsTIGR015579.1E-19111165IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MLTKCKYQVR ISNLGREALD MIEKGKNGFD MVMSDENVGD MDGFVFVEQV GRLETNLPVI  60
XXXXXXXXXX LTVNIDISTK TTTYHGDDGD DGQMVSIKKR IINESSAPVK KPRVVWTSHL  120
HNKFEEVVRQ IGVQHAGPKK ILELMGIPWL SRENVASHLQ VYIIRQDYLY CIHRENEVKA  180
AYAGKNVSNM YGQSGNSLTL QQNIVINENN YCPSNVNGEG NMYGDHHMTY NQQLQLNESS  240
SISRSHYNQT DFNPHFQYDH FPIVSNDPCS SSNCSYFYSK NRHYAITENT TPHHTLSTHY  300
HQQNMNLGPR PALRLQEVEL AELPSALEDI YLQDPHTVCI NSLGCINQGL ISDDHPHSAA  360
HAHDHPDTYE PQVWHQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-15110162456ARR10-B